(data stored in ACNUC7421 zone)

EMBL: CP000438.PE82

CP000438.PE82        Location/Qualifiers
FT   CDS             complement(95911..96453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15036"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ19"
FT                   /protein_id="ABJ15036.1"
FT                   /translation="MKVDPAGAEAQMEAIRRTYRCLVEGLVDVLRTLDNLKGEFRMAQT
FT                   MIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAA
FT                   IRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
FT                   REFSRAYEEHSARLRRS"
     MKVDPAGAEA QMEAIRRTYR CLVEGLVDVL RTLDNLKGEF RMAQTMIQPV QNNPLKFAPN        60
     VDEAMLLLLR RDNQAFMAPD RAVADSFEDL KAHQLAVMAG VQAAIRHLLA RFEPAALEAR       120
     FGKPAGLSGL LPGARQAQNW DSFTELYAKI LREAEDDFQE LFGREFSRAY EEHSARLRRS       180
//

If you have problems or comments...

PBIL Back to PBIL home page