(data stored in ACNUC7421 zone)

EMBL: CP000438.PE83

CP000438.PE83        Location/Qualifiers
FT   CDS             complement(96450..97409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15037"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK07"
FT                   /protein_id="ABJ15037.1"
FT                   /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPER
FT                   LVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQ
FT                   LGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDT
FT                   KPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPLPPATTPAPPPAGGAPLIPADW
FT                   DPFAELLGNTPAPSATPVVQPQPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQP
FT                   QPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQ"
     MPLRLTITSY HKLTPGQCSE KVLDQGQLTI GRGPDNDWVL PDPERLVSSR HCTILNRDGV        60
     YYLTDTSTNG VLLVNAGHRL RRGNSEPLQD GETVRLGEYD ILVQLGHDIA LPGSGNPQTD       120
     PFTSFDALMS RQAAGSAPAF AEPAPTPHPA VTAHFQGGSP LDTKPDLFDF LTPPPPGAAP       180
     RPDHVPAEQH DFRPPEPVIP LPPATTPAPP PAGGAPLIPA DWDPFAELLG NTPAPSATPV       240
     VQPQPAAEPT PLAMPFADPG ITQQPQPQPQ PQPQPQPQPQ PQPQPQPASV AAPTPPASAA       300
     ATAGGDLLQA FLRGAGMTQ                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page