(data stored in ACNUC7421 zone)

EMBL: CP000438.PE84

CP000438.PE84        Location/Qualifiers
FT   CDS             97777..98811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15038"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK28"
FT                   /protein_id="ABJ15038.1"
FT                   /translation="MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDA
FT                   VLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLGQY
FT                   WDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAG
FT                   LQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGVAERVGSAQGLDL
FT                   GPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAATGEQGGAAPVAAVAAPAPRASGEIAN
FT                   REDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRG
FT                   PESE"
     MLDVPVLLAA VSPDSPCGDD LEYDAAFLEL ERIAQGQPER QMGDAVLPAE PPEWPRVRAL        60
     ASELFGRSKD LRVANLLLQS NVALDGLDGL AEGLLLVREL LGQYWDGVYP LLDADDDNDP       120
     TFRINALTGL VAEPLLQLVW AIPLVRSRAF GPVNLRAALN AAGLQRFASE TLSPEQIAGA       180
     FADADADALA ATRRALDGAQ EHALAIESGV AERVGSAQGL DLGPLRQLLR QALQVFDLYG       240
     PQGAGEPLAP GAEAATGEQG GAAPVAAVAA PAPRASGEIA NREDVLRQLD RLLEYYVRHE       300
     PSSPVPVLLK RAKTLVTADF AEIVRNLIPD GISQFETLRG PESE                        344
//

If you have problems or comments...

PBIL Back to PBIL home page