(data stored in ACNUC7421 zone)

EMBL: CP000438.PE85

CP000438.PE85        Location/Qualifiers
FT   CDS             98900..99418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15039"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK88"
FT                   /protein_id="ABJ15039.1"
FT                   /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMAD
FT                   LAGKPAEPQAAVADRKFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESM
FT                   DDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALASAP
FT                   KPKDDEPQA"
     MGSTTSSQKF IARNRAPRVQ IEYDVELYGA EKKVQLPFVM GVMADLAGKP AEPQAAVADR        60
     KFLEIDVDNF DARLKAMKPR VAFNVPNVLT GEGNLSLDIT FESMDDFSPA AVARKVDSLN       120
     KLLEARTQLA NLLTYMDGKT GAEEMIMKAI KDPALLQALA SAPKPKDDEP QA               172
//

If you have problems or comments...

PBIL Back to PBIL home page