(data stored in ACNUC7421 zone)

EMBL: CP000438.PE86

CP000438.PE86        Location/Qualifiers
FT   CDS             99431..100927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15040"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR5"
FT                   /protein_id="ABJ15040.1"
FT                   /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAV
FT                   RTLAEHALEQTSLISNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYL
FT                   VNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCL
FT                   VGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTT
FT                   PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWAN
FT                   SAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCR
FT                   FAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVE
FT                   EVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
     MAELSTENLA QGQTTTEQTS EFASLLLQEF KPKTERAREA VETAVRTLAE HALEQTSLIS        60
     NDAIKSIESI IAALDAKLTA QVNLIMHHAD FQQLESAWRG LHYLVNNTET DEQLKIRVLN       120
     ISKPELHKTL KKFKGTTWDQ SPIFKKLYEE EYGQFGGEPY GCLVGDYYFD QSPPDVELLG       180
     EMAKISAAMH APFISAASPT VMGMGSWQEL SNPRDLTKIF TTPEYAGWRS LRESEDSRYI       240
     GLTMPRFLAR LPYGAKTDPV EEFAFEEETD GADSSKYAWA NSAYAMAVNI NRSFKLYGWC       300
     SRIRGVESGG EVQGLPAHTF PTDDGGVDMK CPTEIAISDR REAELAKNGF MPLLHKKNTD       360
     FAAFIGAQSL QKPAEYDDPD ATANANLAAR LPYLFATCRF AHYLKCIVRD KIGSFKEKDE       420
     MQRWLQDWIL NYVDGDPAHS TETTKAQHPL AAAEVVVEEV EGNPGYYNSK FFLRPHYQLE       480
     GLTVSLRLVS KLPSAKEA                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page