(data stored in ACNUC7421 zone)

EMBL: CP000438.PE87

CP000438.PE87        Location/Qualifiers
FT   CDS             101003..101491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15041"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="PDB:4KSR"
FT                   /db_xref="PDB:4KSS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ24"
FT                   /protein_id="ABJ15041.1"
FT                   /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGG
FT                   GGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKE
FT                   VLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA"
     MAVDMFIKIG DVKGESKDKT HAEEIDVLAW SWGMSQSGSM HMGGGGGAGK VNVQDLSFTK        60
     YIDKSTPNLM MACSSGKHYP QAKLTIRKAG GENQVEYLII TLKEVLVSSV STGGSGGEDR       120
     LTENVTLNFA QVQVDYQPQK ADGAKDGGPV KYGWNIRQNV QA                          162
//

If you have problems or comments...

PBIL Back to PBIL home page