(data stored in ACNUC7421 zone)

EMBL: CP000438.PE88

CP000438.PE88        Location/Qualifiers
FT   CDS             101659..102504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01040"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15042"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK14"
FT                   /protein_id="ABJ15042.1"
FT                   /translation="MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRS
FT                   QPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVF
FT                   AGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAW
FT                   LADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVA
FT                   LLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
FT                   "
     MADPSFASGR LGSRLQGSIA MIAEELLRAG RLDDALKALQ EQVRSQPSNA TLRIFLFQLL        60
     AVMGQWARAQ NQLKVVGELD ASALPMVQTY STAIDCEALR REVFAGRLTP VILGQPAEWI       120
     APLLQALSLD AEGHGEAAQA LREQAFDAAP AVPGRIGEAP FAWLADADTR LGPVLEVIVN       180
     GRYAWLPMSN LRSLKVEAPS DLRDLVWLPA ELTLANGGAT VALLPARYAE TVEHGDDAAR       240
     LGRKTEWLDS GLPVGQRLFV TDAGETALFD LRELDFEPTD A                           281
//

If you have problems or comments...

PBIL Back to PBIL home page