(data stored in ACNUC7421 zone)

EMBL: CP000438.PE89

CP000438.PE89        Location/Qualifiers
FT   CDS             102506..103015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15043"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK32"
FT                   /protein_id="ABJ15043.1"
FT                   /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVL
FT                   RDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATF
FT                   EPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQ
FT                   GERRRT"
     MAELTLQERL QPSLLDRLTD DEPGNLKEAA ERRVLTLSQL KASVLRDLAW LFNTTSLFDH        60
     GPAARMPAGN SVLNYGLPAL AGHTASSVDV HAIEALLTET IATFEPRIIR SSLRVRAQLL       120
     PGEMDHNALS FEIEGDLWAE PAPLRLLLTT NLDLETGHVR VAQGERRRT                   169
//

If you have problems or comments...

PBIL Back to PBIL home page