(data stored in ACNUC7421 zone)

EMBL: CP000438.PE90

CP000438.PE90        Location/Qualifiers
FT   CDS             103012..104871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15044"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK96"
FT                   /protein_id="ABJ15044.1"
FT                   /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPY
FT                   VERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGAL
FT                   SSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPAAVLGRLAASE
FT                   PRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN
FT                   AWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRALR
FT                   RCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVI
FT                   VDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSK
FT                   QRRKGPRSTYVGSETFVALVDANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFT
FT                   LEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGAAALRELLRL
FT                   YGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTGVFLL
FT                   GAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
     MNPRLLEYYN QELQHIRESA AEFAEEFPKI AGRLSLSGFE CADPYVERLL EGFAYLTARV        60
     QLKLDAEYPT FTHNLLEIAY PHYLAPTPSM TVVQLRPDPN EGALSSGFSV ERGASLRGQL       120
     GPDDQTACEY RTAHPVTLWP LEVAQADYFG NPAAVLGRLA ASEPRAKAGL RIRLRSGAGI       180
     PFDSLSLDAL PLYLHGADEQ PYRLYEQLLG NACAVFVRAP DNAWVERLPT SSLRARGFDD       240
     EDALLPVVPR AFQGYRLLQE YFALPARFLF VEFSGLNRAL RRCHGEELEL VVLFGKHDQR       300
     LEGTVDAEQL VPFCTPAINL FPRRCDRIHL SDRVNEHHVI VDRTRPLDFE VHSLQQVSGH       360
     GSGPEQPFQP FYAVRDPARY GREQAYFSVR REPRVLSSKQ RRKGPRSTYV GSETFVALVD       420
     ANQAPYRHDL RQLGIAALCT NRDLPLFMPI GAHKSDFTLE DSAPVMQVRC LAGPSRPRAS       480
     RAHDASAWRL ISQLSLNYLS LAERGQGAAA LRELLRLYGD SGDPALQLQI EGLREVSSKP       540
     CTRRLPMPGP IVFGRGLEIT LDFDENAFRG TGVFLLGAVF ERFLARYVSI NSFTETVLRT       600
     GERGEVMRWQ AKPGSRPNL                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page