(data stored in ACNUC7421 zone)

EMBL: CP000438.PE91

CP000438.PE91        Location/Qualifiers
FT   CDS             104835..105881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15045"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS0"
FT                   /protein_id="ABJ15045.1"
FT                   /translation="MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLG
FT                   HSVRLADDPLRLGQKPDCTFAPSTLASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTE
FT                   YARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAALSG
FT                   RGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQWLELP
FT                   ERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWVA
FT                   EYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPH
FT                   EHKEKEHE"
     MAGEAGQPSE PLNLLAGMAA APWDYDFFQA LRRIECESPQ LPRLGHSVRL ADDPLRLGQK        60
     PDCTFAPSTL ASVSQAGTAA VPRLDQFFFG LTGPNGPLPL HLTEYARERQ RNVNDATFKR       120
     FMDVFHHRLL TLFYRAWAEA RPEISHDRID DDYWSARLAA LSGRGMPSLR GREPLADTAR       180
     YYYTGHLAAQ TRYPDGLRVI LAEYFEVPVA VEEYVGQWLE LPERSRLGVD STSLGMDVCL       240
     GTHVWDRQHK FRLRLGPLDL DQYQRFLPDG DHFVELAAWV AEYLGEELDW DVNLVLQRHE       300
     VPPLGLQGGG RLGFNTWLGD PGQDARDLLL ARQYATARPH EHKEKEHE                    348
//

If you have problems or comments...

PBIL Back to PBIL home page