(data stored in ACNUC7421 zone)

EMBL: CP000438.PE93

CP000438.PE93        Location/Qualifiers
FT   CDS             108629..110560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15047"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK21"
FT                   /protein_id="ABJ15047.1"
FT                   /translation="MQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPN
FT                   LPLEQLLGKPMSLSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTS
FT                   DCRIFQNQSVPEIIKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEG
FT                   IYYWFRHEQKRHILVLSDAYGAHRSPGGYASVPYYPPTLGHRERDHFFDWQMAREVQPG
FT                   SLTLNDYDFQRPGARLEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQA
FT                   QHERVRLRGVVRGIGAGHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQF
FT                   ESELDCIDASQSFRLLPQTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQ
FT                   SNENSSCWIRVSQAWAGKNWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPY
FT                   ELPANATQSGMKSRSSKGGTPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVG
FT                   HDRNKSIGHDELVRIGNNRTRAVKLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSV
FT                   VEFNADGTINISGSAFNLYASGNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQA
FT                   MFPPPAKG"
     MQLTRLVQVD CPLGPDVLLL QRMEGREELG RLFAYELHLV SENPNLPLEQ LLGKPMSLSL        60
     ELPGGSRRFF HGIVARCSQV AGHGQFAGYQ ATLRPWPWLL TRTSDCRIFQ NQSVPEIIKQ       120
     VFRDLGFSDF EDALTRPYRE WEYCVQYRET SFDFISRLME QEGIYYWFRH EQKRHILVLS       180
     DAYGAHRSPG GYASVPYYPP TLGHRERDHF FDWQMAREVQ PGSLTLNDYD FQRPGARLEV       240
     RSNIARPHAA ADYPLYDYPG EYVQSQDGEQ YARNRIEAIQ AQHERVRLRG VVRGIGAGHL       300
     FRLSGYPRDD QNREYLVVGA EYRVVQELYE TGSGGAGSQF ESELDCIDAS QSFRLLPQTP       360
     VPVVRGPQTA VVVGPKGEEI WTDQYGRVKV HFHWDRHDQS NENSSCWIRV SQAWAGKNWG       420
     SMQIPRIGQE VIVSFLEGDP DRPIITGRVY NAEQTVPYEL PANATQSGMK SRSSKGGTPA       480
     NFNEIRMEDK KGAEQLYIHA ERNQDNLVEN DASLSVGHDR NKSIGHDELV RIGNNRTRAV       540
     KLNDTLLVGG AKSDSVTGTY LIEAGAQIRL VCGKSVVEFN ADGTINISGS AFNLYASGNG       600
     NIDTGGRLDL NSGGASEVDA KGKGVQGTID GQVQAMFPPP AKG                         643
//

If you have problems or comments...

PBIL Back to PBIL home page