(data stored in ACNUC7421 zone)

EMBL: CP000438.PE96

CP000438.PE96        Location/Qualifiers
FT   CDS             complement(111195..112514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15050"
FT                   /db_xref="GOA:A0A0H2ZJS4"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS4"
FT                   /protein_id="ABJ15050.1"
FT                   /translation="MVAGAVAGALIGAAVVAATAATGGLAAVILAGSIAAGGLSMFQIV
FT                   KGLTTIFELPEPTTGVLIRGSFNVYVNSRNAMRAGDDVSATCSGLPLNHPLWPFPVLIA
FT                   EGSATVYINGKPAARLQSKMVCGAHIKTGSQNTFIGGPTERVAFVLDLEEWLHTGLEAL
FT                   GLAALAGGLLLAAMAGVAALVGVVAIGGLMMGGMALLGDLGDRLGPGYRDLFQGVAGMA
FT                   LLGFGPKMARLGNAPKGAPKTQVPKGFEKVYGKAPAAKAEIDAVADGLAAKHGGRVAKA
FT                   PIKSRERAMQKINNDYKGDPTKIKDLARNTIIVEGDKVNTVAAELANRGAKVKVIDGNA
FT                   DPLGYSGVNSTMNTKAGIPGEIQVNSPEMIYAKESEDMARILLGNDTYDAVAAKAGVPG
FT                   GQGHKYYEDWRVLDPKSPEAQAIAEKSRAYYDAVRKGNGN"
     MVAGAVAGAL IGAAVVAATA ATGGLAAVIL AGSIAAGGLS MFQIVKGLTT IFELPEPTTG        60
     VLIRGSFNVY VNSRNAMRAG DDVSATCSGL PLNHPLWPFP VLIAEGSATV YINGKPAARL       120
     QSKMVCGAHI KTGSQNTFIG GPTERVAFVL DLEEWLHTGL EALGLAALAG GLLLAAMAGV       180
     AALVGVVAIG GLMMGGMALL GDLGDRLGPG YRDLFQGVAG MALLGFGPKM ARLGNAPKGA       240
     PKTQVPKGFE KVYGKAPAAK AEIDAVADGL AAKHGGRVAK APIKSRERAM QKINNDYKGD       300
     PTKIKDLARN TIIVEGDKVN TVAAELANRG AKVKVIDGNA DPLGYSGVNS TMNTKAGIPG       360
     EIQVNSPEMI YAKESEDMAR ILLGNDTYDA VAAKAGVPGG QGHKYYEDWR VLDPKSPEAQ       420
     AIAEKSRAYY DAVRKGNGN                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page