(data stored in ACNUC7421 zone)

EMBL: CP000438.PE97

CP000438.PE97        Location/Qualifiers
FT   CDS             complement(112593..113027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15051"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ35"
FT                   /protein_id="ABJ15051.1"
FT                   /translation="MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDAS
FT                   QGDAPFADYVARQLENAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVF
FT                   IERRPAVLITTLTTTPADLPHHEPAWKQAMQTLVPRPTPS"
     MTLYRLHEAD LEIPDAWQDQ SINIFKLPAS GPAREASFVI SRDASQGDAP FADYVARQLE        60
     NAEKQLPGFK LHKRWDINIH GHAAVLLDYQ WQREGRDLML RQVFIERRPA VLITTLTTTP       120
     ADLPHHEPAW KQAMQTLVPR PTPS                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page