(data stored in ACNUC7421 zone)

EMBL: CP000438.PE98

CP000438.PE98        Location/Qualifiers
FT   CDS             113281..115506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15052"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK27"
FT                   /protein_id="ABJ15052.1"
FT                   /translation="MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISE
FT                   NPDLPLDGLLGKPASLALELHDGSRRHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLT
FT                   RTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLME
FT                   QEGIYYWFRHERNRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRERDHFYDWHMAREV
FT                   QSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIEA
FT                   LQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGADYRVVQELYETGGGGVG
FT                   AQFESELDCIDAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDR
FT                   HDQSNENSSCWIRVSQAWAGKNWGSVQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQT
FT                   VPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAEKNQDIEVENDESH
FT                   WVGHDRTKTIDYDETVHVKHDRTETVDNNETITIGVDRTEKVGNNEKISIGANRTEDVG
FT                   SNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETISIGADR
FT                   SESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLV
FT                   TGAASIRMKKDGSIVISGKNITIDGSGAINIKADKNVVVKGRKILQN"
     MALAQQTRLV RVDSPLGAEV LQLQRMEGRE ELGRPFAYEL ELISENPDLP LDGLLGKPAS        60
     LALELHDGSR RHFHGIVAAC SQGSGNGQFA SYQVTLRPWL WLLTRTSDCR IFQNQKVPDI       120
     IKQVFRDLGF SDFEDALSRS YREWEYCVQY RETSFDFVSR LMEQEGIYYW FRHERNRHIL       180
     VLSDAYGAHQ SPPNYASVPY YPPTLEQRER DHFYDWHMAR EVQSGSLSLN DYDFQRPGAR       240
     LEVRSNIARS HAAADYPLYD YPGEYVQSQD GEQYARTRIE ALQARYERVR LRGRARGLGS       300
     GHLFKLSGYP REDQNREYLV VGADYRVVQE LYETGGGGVG AQFESELDCI DAGQAYRPLP       360
     TTPLPIVRGP QTAVVVGPKG EEIWTDQYGR VKVHFHWDRH DQSNENSSCW IRVSQAWAGK       420
     NWGSVQIPRI GQEVIVSFLE GDPDRPIITG RVYNAEQTVP YELPANATQS GTKSRSSKGG       480
     TPANFNEIRM EDKKGAEQLF IHAEKNQDIE VENDESHWVG HDRTKTIDYD ETVHVKHDRT       540
     ETVDNNETIT IGVDRTEKVG NNEKISIGAN RTEDVGSNET ISIGVDRTEK VGSNEKISIG       600
     ANRTEDVGND ETISIGANRS ESVGNNETIS IGADRSESVG ANETIDIGGN QSTSIGKNES       660
     RSVGQGRDTS VGKDDSLDVG KSFTLNAGDS ITLVTGAASI RMKKDGSIVI SGKNITIDGS       720
     GAINIKADKN VVVKGRKILQ N                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page