(data stored in ACNUC7421 zone)

EMBL: CP000438.PE99

CP000438.PE99        Location/Qualifiers
FT   CDS             115534..115983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK40"
FT                   /protein_id="ABJ15053.1"
FT                   /translation="MSVEIHLPGATTALPARLDGVVIGVLLDVPDAAAPVVAYPGCPSE
FT                   HGLAAATTTQLSRADIGAQVALMFVAGDPRQPLLIGRIQRLPQEALAQLDGERLEFSAE
FT                   REIVLRCGKASITLTRAGKVIIHGAYLSSRSTGVNRIKGGSVQIN"
     MSVEIHLPGA TTALPARLDG VVIGVLLDVP DAAAPVVAYP GCPSEHGLAA ATTTQLSRAD        60
     IGAQVALMFV AGDPRQPLLI GRIQRLPQEA LAQLDGERLE FSAEREIVLR CGKASITLTR       120
     AGKVIIHGAY LSSRSTGVNR IKGGSVQIN                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page