(data stored in ACNUC7421 zone)

EMBL: CP000438.PGK

CP000438.PGK         Location/Qualifiers
FT   CDS             621256..622419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="PA14_07190"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15515"
FT                   /db_xref="GOA:Q02TL3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TL3"
FT                   /protein_id="ABJ15515.1"
FT                   /translation="MTVLKMTDLDLKGKRVLIREDLNVPVKDGQVQSDARIKAALPTLK
FT                   LALEKGAAVMVCSHLGRPTEGEFSAENSLKPVAEYLSKALGREVPLLADYLDGVEVKAG
FT                   DLVLFENVRFNKGEKKNADELAQKYAALCDVFVMDAFGTAHRAEGSTHGVARFAKVAAA
FT                   GPLLAAELDALGKALGNPARPMAAIVAGSKVSTKLDVLNSLAGICDQLIVGGGIANTFL
FT                   AAAGHKVGKSLYEADLVETAKAIAAKVKVPLPVDVVVAKEFAESAVATVKAIAEVADDD
FT                   MILDIGPQTAAQFAELLKTSKTILWNGPVGVFEFDQFGEGTRTLANAIADSAAFSIAGG
FT                   GDTLAAIDKYGIAERISYISTGGGAFLEFVEGKVLPAVEILEQRAKG"
     MTVLKMTDLD LKGKRVLIRE DLNVPVKDGQ VQSDARIKAA LPTLKLALEK GAAVMVCSHL        60
     GRPTEGEFSA ENSLKPVAEY LSKALGREVP LLADYLDGVE VKAGDLVLFE NVRFNKGEKK       120
     NADELAQKYA ALCDVFVMDA FGTAHRAEGS THGVARFAKV AAAGPLLAAE LDALGKALGN       180
     PARPMAAIVA GSKVSTKLDV LNSLAGICDQ LIVGGGIANT FLAAAGHKVG KSLYEADLVE       240
     TAKAIAAKVK VPLPVDVVVA KEFAESAVAT VKAIAEVADD DMILDIGPQT AAQFAELLKT       300
     SKTILWNGPV GVFEFDQFGE GTRTLANAIA DSAAFSIAGG GDTLAAIDKY GIAERISYIS       360
     TGGGAFLEFV EGKVLPAVEI LEQRAKG                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page