(data stored in ACNUC7421 zone)

EMBL: CP000438.PHNA

CP000438.PHNA        Location/Qualifiers
FT   CDS             143458..143799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="PA14_01560"
FT                   /product="putative alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15085"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK57"
FT                   /protein_id="ABJ15085.1"
FT                   /translation="MSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKV
FT                   IKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMK
FT                   LKSEFVRKV"
     MSTLPPCPQC NSEYTYEDGA LLVCPECAHE WSPNEAATAS DDGKVIKDSV GNVLQDGDTI        60
     TVIKDLKVKG SSLVVKVGTK VKNIRLVDGD HDIDCKIDGI GAMKLKSEFV RKV              113
//

If you have problems or comments...

PBIL Back to PBIL home page