(data stored in ACNUC7421 zone)

EMBL: CP000438.PHZH

CP000438.PHZH        Location/Qualifiers
FT   CDS             64665..66497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzH"
FT                   /locus_tag="PA14_00640"
FT                   /product="potential phenazine-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15009"
FT                   /db_xref="GOA:A0A0H2ZJN6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJN6"
FT                   /protein_id="ABJ15009.1"
FT                   /translation="MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNAL
FT                   LGHRRLAVIDLSGGVQPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRSDT
FT                   EVVLHAYLQWGERCCEYLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLLFGS
FT                   EIKSILAHPEFAARLDAVGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQAKLRR
FT                   YWEVRRQEHADDLQSTVQRTRELVTRALGSQLHADVPVCSLLSGGLDSTALTGIAQRIA
FT                   KAEHGGDINSFSVDFVGQAEQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIDNAELVC
FT                   ERAREEVFRAKDVPFTFGDMDTSLHLMFGEIRRHSTVAISGEGADELFGGYGWFRDPQA
FT                   VAAARFPWASRVRLPAGFIDAGFNRRCDLLQYQQASYDDGLRQVEHLAGDSPEERRMRE
FT                   FSHLHLKRWMVLLLERKDRLSMCNGLEVRVPYTDHELVEYVYNVPWSIKSRDGEEKWLL
FT                   KRACADYVPEAVLKRRKSPYPTSANLGYERFLRGSVRRLLEDAANPVFGIVSREFLAAE
FT                   LEHPEGYFNTQVSRHNLETALALEGWLRLYGLSA"
     MCGLAGWVDY TRKLDDEFPA IFAMTDTLAL RGPDAEGIWK HRNALLGHRR LAVIDLSGGV        60
     QPMSYRFPTG QEVTLVYTGE VYNHDALRER LRRAGHEFRT RSDTEVVLHA YLQWGERCCE       120
     YLTGMFAFAV FDGRDGHLLL VRDRLGIKPL YYARHREGLL FGSEIKSILA HPEFAARLDA       180
     VGLVDLLTLS RGTSQTPFRE VQELLPGHLL SWRPNSQAKL RRYWEVRRQE HADDLQSTVQ       240
     RTRELVTRAL GSQLHADVPV CSLLSGGLDS TALTGIAQRI AKAEHGGDIN SFSVDFVGQA       300
     EQFRSDDLRP DQDQPFALLA AQYIGSRHRT VLIDNAELVC ERAREEVFRA KDVPFTFGDM       360
     DTSLHLMFGE IRRHSTVAIS GEGADELFGG YGWFRDPQAV AAARFPWASR VRLPAGFIDA       420
     GFNRRCDLLQ YQQASYDDGL RQVEHLAGDS PEERRMREFS HLHLKRWMVL LLERKDRLSM       480
     CNGLEVRVPY TDHELVEYVY NVPWSIKSRD GEEKWLLKRA CADYVPEAVL KRRKSPYPTS       540
     ANLGYERFLR GSVRRLLEDA ANPVFGIVSR EFLAAELEHP EGYFNTQVSR HNLETALALE       600
     GWLRLYGLSA                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page