(data stored in ACNUC7421 zone)

EMBL: CP000438.PILI

CP000438.PILI        Location/Qualifiers
FT   CDS             465247..465783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilI"
FT                   /locus_tag="PA14_05340"
FT                   /product="type IV pili signal transduction protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15377"
FT                   /db_xref="GOA:A0A0H2ZL98"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL98"
FT                   /protein_id="ABJ15377.1"
FT                   /translation="MSDVQTPFQLLVDIDQRCRRLAAGLPAQQEAVQSWSGIGFRMGGR
FT                   FFVAPMGEVGEVLHEPRYTQLPGVKTWVKGVANVRGRLLPIMDLCGFLGTELSPLRKQR
FT                   RVLVVEHLDVFAGLIVDEVFGMQHFPVDTFSEQLPPLEAALQPFIHGVFHREQPWLVFS
FT                   PHALAQHQGFLDVAV"
     MSDVQTPFQL LVDIDQRCRR LAAGLPAQQE AVQSWSGIGF RMGGRFFVAP MGEVGEVLHE        60
     PRYTQLPGVK TWVKGVANVR GRLLPIMDLC GFLGTELSPL RKQRRVLVVE HLDVFAGLIV       120
     DEVFGMQHFP VDTFSEQLPP LEAALQPFIH GVFHREQPWL VFSPHALAQH QGFLDVAV         178
//

If you have problems or comments...

PBIL Back to PBIL home page