(data stored in ACNUC7421 zone)

EMBL: CP000438.PILT

CP000438.PILT        Location/Qualifiers
FT   CDS             451306..452340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="PA14_05180"
FT                   /product="twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15362"
FT                   /db_xref="GOA:A0A0H2ZKV1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV1"
FT                   /protein_id="ABJ15362.1"
FT                   /translation="MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHK
FT                   QVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVL
FT                   TMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIE
FT                   FVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGH
FT                   LVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKIGGGRVAAHE
FT                   IMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGLVAKGLISRENAREKAKI
FT                   PENF"
     MDITELLAFS AKQGASDLHL SAGLPPMIRV DGDVRRINLP PLEHKQVHAL IYDIMNDKQR        60
     KDFEEFLETD FSFEVPGVAR FRVNAFNQNR GAGAVFRTIP SKVLTMEELG MGEVFKRVSD       120
     VPRGLVLVTG PTGSGKSTTL AAMLDYLNNT KYHHILTIED PIEFVHESKK CLVNQREVHR       180
     DTLGFSEALR SALREDPDII LVGEMRDLET IRLALTAAET GHLVFGTLHT TSAAKTIDRV       240
     VDVFPAEEKA MVRSMLSESL QSVISQTLIK KIGGGRVAAH EIMIGTPAIR NLIREDKVAQ       300
     MYSAIQTGGS LGMQTLDMCL KGLVAKGLIS RENAREKAKI PENF                        344
//

If you have problems or comments...

PBIL Back to PBIL home page