(data stored in ACNUC7421 zone)

EMBL: CP000438.PILU

CP000438.PILU        Location/Qualifiers
FT   CDS             452518..453666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilU"
FT                   /locus_tag="PA14_05190"
FT                   /product="twitching motility protein PilU"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15363"
FT                   /db_xref="GOA:A0A0H2ZL88"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL88"
FT                   /protein_id="ABJ15363.1"
FT                   /translation="MEFEKLLRLMVEKGGSDLFITAGVPPSMKVNGRVMPVTKTPLSPE
FT                   QTRETVLGVMNEQQRRDFAENHECNFAISARGIGRFRVSAFYQRNLVGMVLRRIETNIP
FT                   TLEELKLPEILKKLALTKRGLVIFVGATGTGKSTSLAAMIGYRNKNSTGHIISIEDPIE
FT                   YIHQHQGCIVTQREVGLDTDSFEVALKNTLRQAPDVIMIGEVRSRETMDHAVAFAETGH
FT                   LCLATLHANNANQALERIIHFFPADRHGQVWMDLSLNLKAIVAQQLVPTPDGKGRRAVI
FT                   EVLLNTPLAADLIRKGEVHELKPLMKRSTEQGMQTFDQALYQLYTQGEITYEDALAHAD
FT                   SANDLRLMIKLGSESDADHLSNLTQGLSLEITDDDPAGRRFR"
     MEFEKLLRLM VEKGGSDLFI TAGVPPSMKV NGRVMPVTKT PLSPEQTRET VLGVMNEQQR        60
     RDFAENHECN FAISARGIGR FRVSAFYQRN LVGMVLRRIE TNIPTLEELK LPEILKKLAL       120
     TKRGLVIFVG ATGTGKSTSL AAMIGYRNKN STGHIISIED PIEYIHQHQG CIVTQREVGL       180
     DTDSFEVALK NTLRQAPDVI MIGEVRSRET MDHAVAFAET GHLCLATLHA NNANQALERI       240
     IHFFPADRHG QVWMDLSLNL KAIVAQQLVP TPDGKGRRAV IEVLLNTPLA ADLIRKGEVH       300
     ELKPLMKRST EQGMQTFDQA LYQLYTQGEI TYEDALAHAD SANDLRLMIK LGSESDADHL       360
     SNLTQGLSLE ITDDDPAGRR FR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page