(data stored in ACNUC7421 zone)

EMBL: CP000438.PNTB

CP000438.PNTB        Location/Qualifiers
FT   CDS             222339..223775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="PA14_02470"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15151"
FT                   /db_xref="GOA:A0A0H2ZJD6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJD6"
FT                   /protein_id="ABJ15151.1"
FT                   /translation="MSMNLVTLLYLIASVCFIQALKGLSHPTTSRRGNLFGMVGMAIAV
FT                   ATTVGLVFKLGAEIATTGVGYIVVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVAHLGDTIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGTPVQFSGQHLLNLVLGLATLGLGLVFMFTGNLTAFAVMLALAFVLGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGAEADAGGPAGSKEQRPVKSGSADDASFLLTNADSVIIVPGYGLAVARAQHA
FT                   LMELAEKLTHRGVTVKFAIHPVAGRMPGHMNVLLAEAEVPYEQVFEMEDINSEFGQTDV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAYKAKTVIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
     MSMNLVTLLY LIASVCFIQA LKGLSHPTTS RRGNLFGMVG MAIAVATTVG LVFKLGAEIA        60
     TTGVGYIVVG LLVGGTAGSI MAKRVEMTKM PELVAFMHSM IGLAAVFIAI AAVVEPQSLG       120
     IVAHLGDTIP TGNRLELFLG AAIGAITFSG SVIAFGKLSG KYKFRLFQGT PVQFSGQHLL       180
     NLVLGLATLG LGLVFMFTGN LTAFAVMLAL AFVLGVLIII PIGGADMPVV VSMLNSYSGW       240
     AAAGIGFSLN NSMLIIAGSL VGSSGAILSY IMCKAMNRSF FNVILGGFGA EADAGGPAGS       300
     KEQRPVKSGS ADDASFLLTN ADSVIIVPGY GLAVARAQHA LMELAEKLTH RGVTVKFAIH       360
     PVAGRMPGHM NVLLAEAEVP YEQVFEMEDI NSEFGQTDVV LVLGANDVVN PAAKNDPKSP       420
     IAGMPILEAY KAKTVIVNKR SMASGYAGLD NELFYLDKTM MVFGDAKKVI EDMVKAVE         478
//

If you have problems or comments...

PBIL Back to PBIL home page