(data stored in ACNUC7421 zone)

EMBL: CP000438.PPKA

CP000438.PPKA        Location/Qualifiers
FT   CDS             complement(84645..87743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppkA"
FT                   /locus_tag="PA14_00875"
FT                   /product="serine/threonine protein kinase PpkA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15671"
FT                   /db_xref="GOA:A0A0H2ZKT3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT3"
FT                   /protein_id="ABJ15671.1"
FT                   /translation="MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAA
FT                   DPSFAERFLREGRTLARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPE
FT                   QGLAYVRQVAAALGYAHSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQV
FT                   GFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEP
FT                   LPELPIEQGRYQDILRQLLAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGS
FT                   PRASNPPPAEPAPLPPADLGGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPP
FT                   LPPAKPRAGGSRTPLIAAAAAAVLLAIGGGAWWLLGSDDAPSPVDPAPLGQTPTDKPQQ
FT                   QTPVADAEQDGGERPLLMPGKKTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYA
FT                   RKQVGGSPWLRVGASSNGEGDGWLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVE
FT                   RLLGDTRAARDTLTQAVDHKGDPQVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPA
FT                   QLLEVASIDPGGSATAPQAPGQAGRGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVRE
FT                   VIDGLQRQIGERGDLDKVSFGLVGFRNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSS
FT                   QVRATDVSSHSFNEDAFAGIMQAVDEMDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNE
FT                   AEVRQAALRKGVKIYALHLRTPAGKNNHGYAEQQYRSLTADANPKIADLYIPVAGGEVN
FT                   AFGNTVKEIGTVFADLVHDAGNRKPQAPRFDAAPSVASKSAAIGYAMQMEFLGRRDPVR
FT                   APQVVTAWTADRDLTNPALPAFQVCVLLSKLQLNELQQSLKLIVDAAKRTQTSPKDFFQ
FT                   EIASASAYMSRDPAQLVKGSNLAQSGVLGEYLEGLPYRSKSLNMTQDLWLSLSVAEQQD
FT                   FIDELESKIRLYETFHNDVANWVRFGDADAGDALYRVPLSTLP"
     MDIELPGFDI ERELGEGAMA TVYLATQRSL QRKVALKVMA AALAADPSFA ERFLREGRTL        60
     ARLSHPNTVT IHDIGNVGSC YYMAMEYLPN GTLKERIQQG LDPEQGLAYV RQVAAALGYA       120
     HSQGLVHRDV KPANILFRAD GTAVLSDFGI AKSIEDNTQF TQVGFAVGTP SYMSPEQARG       180
     QEIDGRADLY ALGVVLYEIL TGKLPYNGKD SLSTALAHLT EPLPELPIEQ GRYQDILRQL       240
     LAKDPAERFP TAGALIAALD RLAPSALEAT QIRPLATPQG SPRASNPPPA EPAPLPPADL       300
     GGLQPVSIQL PPVTPSAGGA TPPPPPPSQA AKPPSPPPPP LPPAKPRAGG SRTPLIAAAA       360
     AAVLLAIGGG AWWLLGSDDA PSPVDPAPLG QTPTDKPQQQ TPVADAEQDG GERPLLMPGK       420
     KTLFQRVLTK PGAAISAEAG GPPRAGAVPA FSVLYVYARK QVGGSPWLRV GASSNGEGDG       480
     WLPASAVSDW KQSLVLKFTE RSGRAPVMFL NSAEQVERLL GDTRAARDTL TQAVDHKGDP       540
     QVVAVEPNDR AIPQDQFYLL PIFDSKESFD ADGQPAQLLE VASIDPGGSA TAPQAPGQAG       600
     RGGASGAASD TFRTGIVLVV DTSVSMQPYI DRVREVIDGL QRQIGERGDL DKVSFGLVGF       660
     RNNTDKTPGL EYVSKTLVPL QPGNDAQRFA ELSSQVRATD VSSHSFNEDA FAGIMQAVDE       720
     MDWSPYAGRV VLLVTDAGAL RKNDPLGRTQ MNEAEVRQAA LRKGVKIYAL HLRTPAGKNN       780
     HGYAEQQYRS LTADANPKIA DLYIPVAGGE VNAFGNTVKE IGTVFADLVH DAGNRKPQAP       840
     RFDAAPSVAS KSAAIGYAMQ MEFLGRRDPV RAPQVVTAWT ADRDLTNPAL PAFQVCVLLS       900
     KLQLNELQQS LKLIVDAAKR TQTSPKDFFQ EIASASAYMS RDPAQLVKGS NLAQSGVLGE       960
     YLEGLPYRSK SLNMTQDLWL SLSVAEQQDF IDELESKIRL YETFHNDVAN WVRFGDADAG      1020
     DALYRVPLST LP                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page