(data stored in ACNUC7421 zone)

EMBL: CP000438.PRKA

CP000438.PRKA        Location/Qualifiers
FT   CDS             complement(659551..661473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="PA14_07680"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15552"
FT                   /db_xref="GOA:A0A0H2ZKX3"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX3"
FT                   /protein_id="ABJ15552.1"
FT                   /translation="MSIFSHFQERFEATRQEEYSLQEYLDLCKQDKTAYASAAERLLMA
FT                   IGEPELLDTSVDSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVAFFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNPDEDGAILEEDYGI
FT                   PRRYLRSIMSPWATKRLNEFGGDISQFRVVKLYPSILNQIAIAKTEPGDENNQDISALV
FT                   GKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGALPYSGIILAHSNESEWHSFRNNKNNEAFIDRIYIVKVPYCLRVADEIKIYDK
FT                   LLVNSSLAHAHCAPDTLKMLSQFSVLSRLKEPENSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMAGLSTRFAFKILSKVFNFDPHEVAANPVHLLYVLEQQIEQEQFQPE
FT                   TRERYLRFIKEYLAPRYVEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRAALNEELEKIEKPAGISNPKDFRNEIVNFVLRARAGNNGKNPSWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQQKHNDFVKRMVERGYTEKQVRLLSEWYLR
FT                   VRKSQ"
     MSIFSHFQER FEATRQEEYS LQEYLDLCKQ DKTAYASAAE RLLMAIGEPE LLDTSVDSRL        60
     SRIFSNKVIR RYPAFADFHG MEECIDQIVA FFRHAAQGLE EKKQILYLLG PVGGGKSSLA       120
     EKLKQLMEKV PFYAIKGSPV FESPLGLFNP DEDGAILEED YGIPRRYLRS IMSPWATKRL       180
     NEFGGDISQF RVVKLYPSIL NQIAIAKTEP GDENNQDISA LVGKVDIRKL EEYPQNDADA       240
     YSYSGALCRA NQGLMEFVEM FKAPIKVLHP LLTATQEGNY NSTEGLGALP YSGIILAHSN       300
     ESEWHSFRNN KNNEAFIDRI YIVKVPYCLR VADEIKIYDK LLVNSSLAHA HCAPDTLKML       360
     SQFSVLSRLK EPENSNIYSK MRVYDGENLK DTDPKAKSIQ EYRDSAGVDE GMAGLSTRFA       420
     FKILSKVFNF DPHEVAANPV HLLYVLEQQI EQEQFQPETR ERYLRFIKEY LAPRYVEFIG       480
     KEIQTAYLES YSEYGQNIFD RYVLYADFWI QDQEYRDPET GEILNRAALN EELEKIEKPA       540
     GISNPKDFRN EIVNFVLRAR AGNNGKNPSW LSYEKLRVVI EKKMFSNTED LLPVISFNAK       600
     ASKEDQQKHN DFVKRMVERG YTEKQVRLLS EWYLRVRKSQ                             640
//

If you have problems or comments...

PBIL Back to PBIL home page