(data stored in ACNUC7421 zone)

EMBL: CP000438.PTSP

CP000438.PTSP        Location/Qualifiers
FT   CDS             392770..395049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="PA14_04410"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15301"
FT                   /db_xref="GOA:A0A0H2ZKE1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE1"
FT                   /protein_id="ABJ15301.1"
FT                   /translation="MLNTLRKIVQEVNSAKDLKAALGIIVQRVKEAMGTQVCSVYLLDT
FT                   ETQRFVLMATEGLNKRSIGKVSMAPSEGLVGLVGTREEPLNLENAAAHPRYRYFAETGE
FT                   ERYASFLGAPIIHHRRVMGVLVVQQKERRQFDEGEEAFLVTMSAQLAGVIAHAEATGSI
FT                   RGLGKLGKGIQEAKFVGVPGAPGVGVGKAVVVLPPADLEVVPDKQVDDIDAEIALFKQA
FT                   LEGVRADMRALSSKLASQLRKEERALFDVYLMMLDDASIGNEVKRIIRTGQWAQGALRQ
FT                   VVMEHVQRFELMDDAYLRERASDVKDIGRRLLAYLQEERKQNLTYPEQTIIVSEELSPA
FT                   MLGEVPEGRLVGLVSVLGSGNSHVAILARAMGIPTVMGAVDLPYSKVDGIDLIVDGYHG
FT                   EVYTNPSAELVRQYSDVVAEERELSKGLAALRELPCETLDGHRMPLWVNTGLLADVARA
FT                   QERGAEGVGLYRTEVPFMINDRFPSEKEQLAIYREQLSAFHPLPVTMRTLDIGGDKALS
FT                   YFPIKEDNPFLGWRGIRVTLDHPEIFLVQTRAMLKASEGLDNLRILLPMISGTHELEEA
FT                   LHLIHRAWGEVRDEGVDIAMPPIGMMVEIPAAVYQTRELARQVDFLSVGSNDLTQYLLA
FT                   VDRNNPRVADLYDYLHPAVLHALKKVVDDAHLEGKPVSICGEMAGDPAAAVLLMAMGFD
FT                   SLSMNATNLPKVKWLLRQITLDKARDLLGQLLTFDNPQVIHSSLHLALRNLGLGRVINP
FT                   AATVQP"
     MLNTLRKIVQ EVNSAKDLKA ALGIIVQRVK EAMGTQVCSV YLLDTETQRF VLMATEGLNK        60
     RSIGKVSMAP SEGLVGLVGT REEPLNLENA AAHPRYRYFA ETGEERYASF LGAPIIHHRR       120
     VMGVLVVQQK ERRQFDEGEE AFLVTMSAQL AGVIAHAEAT GSIRGLGKLG KGIQEAKFVG       180
     VPGAPGVGVG KAVVVLPPAD LEVVPDKQVD DIDAEIALFK QALEGVRADM RALSSKLASQ       240
     LRKEERALFD VYLMMLDDAS IGNEVKRIIR TGQWAQGALR QVVMEHVQRF ELMDDAYLRE       300
     RASDVKDIGR RLLAYLQEER KQNLTYPEQT IIVSEELSPA MLGEVPEGRL VGLVSVLGSG       360
     NSHVAILARA MGIPTVMGAV DLPYSKVDGI DLIVDGYHGE VYTNPSAELV RQYSDVVAEE       420
     RELSKGLAAL RELPCETLDG HRMPLWVNTG LLADVARAQE RGAEGVGLYR TEVPFMINDR       480
     FPSEKEQLAI YREQLSAFHP LPVTMRTLDI GGDKALSYFP IKEDNPFLGW RGIRVTLDHP       540
     EIFLVQTRAM LKASEGLDNL RILLPMISGT HELEEALHLI HRAWGEVRDE GVDIAMPPIG       600
     MMVEIPAAVY QTRELARQVD FLSVGSNDLT QYLLAVDRNN PRVADLYDYL HPAVLHALKK       660
     VVDDAHLEGK PVSICGEMAG DPAAAVLLMA MGFDSLSMNA TNLPKVKWLL RQITLDKARD       720
     LLGQLLTFDN PQVIHSSLHL ALRNLGLGRV INPAATVQP                              759
//

If you have problems or comments...

PBIL Back to PBIL home page