(data stored in ACNUC7421 zone)

EMBL: CP000438.PYRC

CP000438.PYRC        Location/Qualifiers
FT   CDS             complement(458157..459428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /gene_synonym="pyrX"
FT                   /locus_tag="PA14_05250"
FT                   /product="noncatalytic dihydroorotase-like protein
FT                   noncataly"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05250"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15368"
FT                   /db_xref="GOA:A0A0H2ZL93"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL93"
FT                   /protein_id="ABJ15368.1"
FT                   /translation="MTISIRGARVIDPASGLDQVGDLHIEAGKIVAIGAAPAGFSAQKT
FT                   LDGAGLVAAPGLVDLSVALREPGYGRKGNVESETRAAAAGGTTSLCCPPYTRPVLDTPA
FT                   VAELILDRAREAGNAKVYPIGALTRGFGGEQLSELVALRDTGCVAFTNGLHGFASNRIL
FT                   RRALEYAATFDLTVIFTSQDTDLAEGGLAHEGPTASFLGLAGIPETAETVALARNLLLV
FT                   EQSGVRAHFSQLTSARGIELVAQAQARGLPVTCDVALYQLILTDEALVGFSSLYHVQPP
FT                   LRTKADREALREAVKNGVVQAIASHHQPHEADAKNAPFAATEPGISGAELLLPLAMTLV
FT                   QDGLLDLPTLLARLSHGPAQALRLPAGRLAVGQAADLVLFDPQGSTLAGESWYSKGQNS
FT                   PFVGHCLPGRVRYTLVDGHLTHEG"
     MTISIRGARV IDPASGLDQV GDLHIEAGKI VAIGAAPAGF SAQKTLDGAG LVAAPGLVDL        60
     SVALREPGYG RKGNVESETR AAAAGGTTSL CCPPYTRPVL DTPAVAELIL DRAREAGNAK       120
     VYPIGALTRG FGGEQLSELV ALRDTGCVAF TNGLHGFASN RILRRALEYA ATFDLTVIFT       180
     SQDTDLAEGG LAHEGPTASF LGLAGIPETA ETVALARNLL LVEQSGVRAH FSQLTSARGI       240
     ELVAQAQARG LPVTCDVALY QLILTDEALV GFSSLYHVQP PLRTKADREA LREAVKNGVV       300
     QAIASHHQPH EADAKNAPFA ATEPGISGAE LLLPLAMTLV QDGLLDLPTL LARLSHGPAQ       360
     ALRLPAGRLA VGQAADLVLF DPQGSTLAGE SWYSKGQNSP FVGHCLPGRV RYTLVDGHLT       420
     HEG                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page