(data stored in ACNUC7421 zone)

EMBL: CP000438.RECF

CP000438.RECF        Location/Qualifiers
FT   CDS             3169..4278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PA14_00030"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14959"
FT                   /db_xref="GOA:Q02V78"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02V78"
FT                   /protein_id="ABJ14959.1"
FT                   /translation="MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHL
FT                   LGLARSFRSARLQPVIQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNAR
FT                   SAAQLAETLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRN
FT                   SWLRHGKLDPASQAAWDRELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSY
FT                   YRGWDKDRDLLEVLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLINRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLK
FT                   DGWRTDTPVSMFHVEHGKVSQTTTIGSEA"
     MSLTRVSVTA VRNLHPVTLS PSPRINILYG DNGSGKTSVL EAIHLLGLAR SFRSARLQPV        60
     IQYEEAACTV FGQVMLANGI ASNLGISRER QGEFTIRIDG QNARSAAQLA ETLPLQLINP       120
     DSFRLLEGAP KIRRQFLDWG VFHVEPRFLP VWQRLQKALR QRNSWLRHGK LDPASQAAWD       180
     RELSLASDEI DAYRRSYIQA LKPVFEETLA ELVSLDDLTL SYYRGWDKDR DLLEVLASSL       240
     LRDQQMGHTQ AGPQRADLRI RLAGHNAAEI LSRGQQKLVV CALRIAQGHL INRAKRGQCV       300
     YLVDDLPSEL DEQHRMALCR LLEDLGCQVF ITCVDPQLLK DGWRTDTPVS MFHVEHGKVS       360
     QTTTIGSEA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page