(data stored in ACNUC7421 zone)

EMBL: CP000438.RPSU

CP000438.RPSU        Location/Qualifiers
FT   CDS             complement(651720..651935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PA14_07560"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15543"
FT                   /db_xref="GOA:Q02TI4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TI4"
FT                   /protein_id="ABJ15543.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAER
FT                   KRKAAAAVKRHAKKVQREQRRRERLY"
     MPAVKVKENE PFDVALRRFK RSCEKAGVLA EVRSREFYEK PTAERKRKAA AAVKRHAKKV        60
     QREQRRRERL Y                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page