(data stored in ACNUC7421 zone)

EMBL: CP000438.SBP

CP000438.SBP         Location/Qualifiers
FT   CDS             complement(330946..331944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="PA14_03700"
FT                   /product="sulfate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15246"
FT                   /db_xref="GOA:A0A0H2ZKY4"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY4"
FT                   /protein_id="ABJ15246.1"
FT                   /translation="MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAF
FT                   IKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADW
FT                   QARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAW
FT                   AWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKK
FT                   EQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFY
FT                   RPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ"
     MSLRRFALAA LASALVSGPV AAATQLLNVS YDPTRELYQA YNAAFIKHWK AQGGEDLTVQ        60
     QSHGGSGKQA RAVIDGLKAD VVTLALAGDI DELHKLGKLL PADWQARLPD NSTPYTSTIV       120
     FLVRKGNPKG IKDWGDLTKE GVEVITPNPK TSGGARWNFL AAWAWAKKQY GSDEKAKDYV       180
     QALYKHVPVL DTGARGSTIT FVNNQIGDVL LAWENEAFLA KKEQGGENFE IVVPSISILA       240
     EPPVAVVDKV VEKKGTRKVA EAYLQYLYSE EGQRIAAQNF YRPRNQKVAA EFATQFPKLN       300
     LVTVDSDFGG WKTAQPKFFN DGGIFDQIYQ AQ                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page