(data stored in ACNUC7421 zone)

EMBL: CP000438.SMF

CP000438.SMF         Location/Qualifiers
FT   CDS             22893..23981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="PA14_00230"
FT                   /product="putative Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14977"
FT                   /db_xref="GOA:A0A0H2ZIX1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIX1"
FT                   /protein_id="ABJ14977.1"
FT                   /translation="MKNHSPAELEARLRLHGLPELGPMRFLRLIEAFGSASSALAAPAG
FT                   AWRTLGVPAEAAAARRSPAVREAAGEALRWLEGPRRHLLMWDDPGYPALLAEVADAPPL
FT                   LYVEGAPETLERPQLAMVGSRRASPAGLGTARSFARSLAQGGFAITSGLALGIDGAAHE
FT                   GALEVGGVTVAVLGTGLRRLYPRRHEALARRIVEGGGALVSELPLDSPPLPANFPRRNR
FT                   IISGLSLGVLVVEASPASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDGALL
FT                   VESVGHVLEALRGWAQAEPAEAPAQPLPHPLLALLRAAPYTSEGLAAASGMTLPDVLAT
FT                   LSELELDGRVACEAGTWVHRSG"
     MKNHSPAELE ARLRLHGLPE LGPMRFLRLI EAFGSASSAL AAPAGAWRTL GVPAEAAAAR        60
     RSPAVREAAG EALRWLEGPR RHLLMWDDPG YPALLAEVAD APPLLYVEGA PETLERPQLA       120
     MVGSRRASPA GLGTARSFAR SLAQGGFAIT SGLALGIDGA AHEGALEVGG VTVAVLGTGL       180
     RRLYPRRHEA LARRIVEGGG ALVSELPLDS PPLPANFPRR NRIISGLSLG VLVVEASPAS       240
     GSLITARLAA EQGREVYAIP GSIHHPGARG CHQLIRDGAL LVESVGHVLE ALRGWAQAEP       300
     AEAPAQPLPH PLLALLRAAP YTSEGLAAAS GMTLPDVLAT LSELELDGRV ACEAGTWVHR       360
     SG                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page