(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUD

CP000438.SPUD        Location/Qualifiers
FT   CDS             352562..353665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuD"
FT                   /locus_tag="PA14_03920"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15262"
FT                   /db_xref="GOA:Q02UB7"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UB7"
FT                   /protein_id="ABJ15262.1"
FT                   /translation="MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLE
FT                   KFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKL
FT                   PNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFK
FT                   PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFH
FT                   SSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPK
FT                   DAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMK
FT                   KLYTFPDLPAKTQRAMTRSWTKIKSGK"
     MMKRFGKTLL ALTLAGSVAG MAQAADNKVL HVYNWSDYIA PDTLEKFTKE TGIKVVYDVY        60
     DSNEVLEAKL LAGKSGYDVV VPSNSFLAKQ IKAGVYQKLD KSKLPNWKNL NKDLMHTLEV       120
     SDPGNEHAIP YMWGTIGIGY NPDKVKAAFG DNAPVDSWDL VFKPENIQKL KQCGVSFLDS       180
     PTEILPAALH YLGYKPDTDN PKELKAAEEL FLKIRPYVTY FHSSKYISDL ANGNICVAIG       240
     YSGDIYQAKS RAEEAKNKVT VKYNIPKEGA GSFFDMVAIP KDAENTEGAL AFVNFLMKPE       300
     IMAEITDVVQ FPNGNAAATP LVSEAIRNDP GIYPSEEVMK KLYTFPDLPA KTQRAMTRSW       360
     TKIKSGK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page