(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUE

CP000438.SPUE        Location/Qualifiers
FT   CDS             354084..355181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuE"
FT                   /gene_synonym="potF2"
FT                   /locus_tag="PA14_03930"
FT                   /product="polyamine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03930"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15263"
FT                   /db_xref="GOA:A0A0H2ZL00"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL00"
FT                   /protein_id="ABJ15263.1"
FT                   /translation="MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKD
FT                   FTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLP
FT                   NWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPE
FT                   NMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSS
FT                   KYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADA
FT                   KAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKL
FT                   YVSAVLPAKVLRLQTRTWTRIKTGK"
     MQHSIGKTLL VAALATAIAG PVQAEKKSLH IYNWTDYIAP TTLKDFTKES GIDVSYDVFD        60
     SNETLEGKLV SGHSGYDIVV PSNNFLGKQI QAGAFQKLDK SKLPNWKNLD PALLKQLEVS       120
     DPGNQYAVPY LWGTNGIGYN VAKVKEVLGD QPIDSWAILF EPENMKKLAK CGVAFMDSGD       180
     EMLPAALNYL GLDPNTHDPK DYKKAEEVLT KVRPYVSYFH SSKYISDLAN GNICVAFGYS       240
     GDVFQAAARA EEAGKGIDIQ YVIPKEGANL WFDLMAIPAD AKAADNAYAF IDYLLRPEVI       300
     AKVSDYVGYA NAIPGARPLM DKSVSDSEEV YPPQAVLDKL YVSAVLPAKV LRLQTRTWTR       360
     IKTGK                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page