(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUF

CP000438.SPUF        Location/Qualifiers
FT   CDS             355236..356390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuF"
FT                   /gene_synonym="potG"
FT                   /locus_tag="PA14_03940"
FT                   /product="polyamine transport protein PotG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15264"
FT                   /db_xref="GOA:A0A0H2ZKB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB1"
FT                   /protein_id="ABJ15264.1"
FT                   /translation="MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYA
FT                   LFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENP
FT                   IYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVY
FT                   YIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS"
     MAIASGAYKK ALEGNQQPKE VLVKIDRVTK QFDETLAVDT VSLTINKGEI FALLGGSGSG        60
     KSTLLRMLAG FERPTEGRIF LDGQDITDLP PYERPINMMF QSYALFPHMS VAQNIAFGLK       120
     QDGLPKAEID ERVAEMLKLV HMTQYAKRKP HQLSGGQRQR VALARSLAKR PKLLLLDEPM       180
     GALDKKLRSQ MQLELVEIIE RVGVTCVMVT HDQEEAMTMA QRIAIMHLGC IEQIGSPMDI       240
     YETPASRLVC EFIGNVNLFD GVLVEDVQDH AVIACPQLEN PIYIGHGIST RAEDKRITYA       300
     LRPEKVMISA QKPDNLEHAG HNWAQGTVYD IAYLGGHSVY YIKLASGMIV QAFMANAERH       360
     VARPTWDQSV YISWYDDSGV VLQS                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page