(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUG

CP000438.SPUG        Location/Qualifiers
FT   CDS             356417..357298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuG"
FT                   /gene_synonym="potH"
FT                   /locus_tag="PA14_03950"
FT                   /product="polyamine transport protein PotH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03950"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15265"
FT                   /db_xref="GOA:A0A0H2ZJU9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU9"
FT                   /protein_id="ABJ15265.1"
FT                   /translation="MPTGRHAVIGVPFLWLFLFFLLPFAIVLKISLAEADVAIPPYTEI
FT                   FAYADQQLQVLLNLGNYLMLTDDPLYIDAYLGSLKMAFISTLICLLVGYPMAYAIARSS
FT                   QSSQTVLLLLIMMPTWTAILIRVYAWMGILSNNGLLNSVLMGLGLISEPLTILNTNIAV
FT                   YIGIVYSYLPFMILPLYANLVKHDPSLLEAASDLGARNFTSFWKITVPLSKNGIIAGCM
FT                   LVFIPAVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLAILIIPIILF
FT                   NKNQAKELEGKV"
     MPTGRHAVIG VPFLWLFLFF LLPFAIVLKI SLAEADVAIP PYTEIFAYAD QQLQVLLNLG        60
     NYLMLTDDPL YIDAYLGSLK MAFISTLICL LVGYPMAYAI ARSSQSSQTV LLLLIMMPTW       120
     TAILIRVYAW MGILSNNGLL NSVLMGLGLI SEPLTILNTN IAVYIGIVYS YLPFMILPLY       180
     ANLVKHDPSL LEAASDLGAR NFTSFWKITV PLSKNGIIAG CMLVFIPAVG EFVIPELLGG       240
     PETLMIGKVL WQEFFNNRDW PVASALAVVM LAILIIPIIL FNKNQAKELE GKV              293
//

If you have problems or comments...

PBIL Back to PBIL home page