(data stored in ACNUC7421 zone)

EMBL: CP000438.SPUH

CP000438.SPUH        Location/Qualifiers
FT   CDS             357381..358250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spuH"
FT                   /gene_synonym="potI"
FT                   /locus_tag="PA14_03960"
FT                   /product="polyamine transport protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15266"
FT                   /db_xref="GOA:A0A0H2ZKT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT6"
FT                   /protein_id="ABJ15266.1"
FT                   /translation="MKRWNFSNVMLIVGLLFIYLPMLILVIYSFNASKLVTVWGGWSVK
FT                   WYVGLLDNTQLVSSVGRSLEIAFYTAFSSVLLGTLAAFVLTRIPRFRGRTLFGGMVTAP
FT                   LVMPEVITGLSLLLLFVAMAQLIGWPQERGIVTIWIAHTSFCSSYVAVVVSARLRELDL
FT                   SIEEAAMDLGAKPWKVFLLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEVFSAVRLGVKPEINAVASLILLSVSLFTFFAWYFTRQAEERRRRAIQQAMEETATDW
FT                   QKGSPTPA"
     MKRWNFSNVM LIVGLLFIYL PMLILVIYSF NASKLVTVWG GWSVKWYVGL LDNTQLVSSV        60
     GRSLEIAFYT AFSSVLLGTL AAFVLTRIPR FRGRTLFGGM VTAPLVMPEV ITGLSLLLLF       120
     VAMAQLIGWP QERGIVTIWI AHTSFCSSYV AVVVSARLRE LDLSIEEAAM DLGAKPWKVF       180
     LLITIPMIAP SLAAGGMMSF ALSLDDLVLA SFVSGPGSTT LPMEVFSAVR LGVKPEINAV       240
     ASLILLSVSL FTFFAWYFTR QAEERRRRAI QQAMEETATD WQKGSPTPA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page