(data stored in ACNUC7421 zone)

EMBL: CP000438.THIG

CP000438.THIG        Location/Qualifiers
FT   CDS             438455..439252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="PA14_04980"
FT                   /product="thiamine biosynthesis protein, thiazole moiety"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15347"
FT                   /db_xref="GOA:Q02U32"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U32"
FT                   /protein_id="ABJ15347.1"
FT                   /translation="MSQASSTDTPFVIAGRTYGSRLLVGTGKYKDLDETRRAIEASGAE
FT                   IVTVAVRRTNIGQNPDEPNLLDVIPPDRYTILPNTAGCYDAVEAVRTCRLARELLDGHN
FT                   LVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPL
FT                   AGLIGSGLGICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHA
FT                   KDPVMMAEAMKHAIVAGRLAYLAGRMPRKLYASASSPLDGLID"
     MSQASSTDTP FVIAGRTYGS RLLVGTGKYK DLDETRRAIE ASGAEIVTVA VRRTNIGQNP        60
     DEPNLLDVIP PDRYTILPNT AGCYDAVEAV RTCRLARELL DGHNLVKLEV LADQKTLFPN       120
     VVETLKAAEQ LVKDGFDVMV YTSDDPIIAR QLAEIGCIAV MPLAGLIGSG LGICNPYNLR       180
     IILEEAKVPV LVDAGVGTAS DAAIAMELGC EAVLMNTAIA HAKDPVMMAE AMKHAIVAGR       240
     LAYLAGRMPR KLYASASSPL DGLID                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page