(data stored in ACNUC7421 zone)

EMBL: CP000438.THIS

CP000438.THIS        Location/Qualifiers
FT   CDS             438196..438396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="PA14_04970"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15346"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH0"
FT                   /protein_id="ABJ15346.1"
FT                   /translation="MQIQLNGEPFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQ
FT                   HASTALKDGDRVEIVHAIGGG"
     MQIQLNGEPF ELPDAQSVAD LLARLELGGR RVAVELNLDI VPRSQHASTA LKDGDRVEIV        60
     HAIGGG                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page