(data stored in ACNUC7421 zone)

EMBL: CP000438.TONB2

CP000438.TONB2       Location/Qualifiers
FT   CDS             224119..224931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB2"
FT                   /locus_tag="PA14_02490"
FT                   /product="putative TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15152"
FT                   /db_xref="GOA:A0A0H2ZKD4"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD4"
FT                   /protein_id="ABJ15152.1"
FT                   /translation="MATPQPVDARTQPWRETPGGDLVALGRPVRQALHLVRHNPAQGRV
FT                   LSRRETILLVLFALTLHGAVIHWLSQQRTPALPEVPPQVPPMTIEFTAPAPPVVEPPPP
FT                   EPLPPVVEEPPPPVVDENAVKPPPPKPVPKPKPKPKPQPRPKPAPKAVEPAPPAPPQPA
FT                   APPAPPAPAAAPAPLTPPSANAGYLHNPAPEYPALAMRRGWEGTVLLRVHVLASGSPSE
FT                   IQVQKSSGREALDQAAVKAVKRWSFVPAKRGDKAEDGWVSVPIDFKLN"
     MATPQPVDAR TQPWRETPGG DLVALGRPVR QALHLVRHNP AQGRVLSRRE TILLVLFALT        60
     LHGAVIHWLS QQRTPALPEV PPQVPPMTIE FTAPAPPVVE PPPPEPLPPV VEEPPPPVVD       120
     ENAVKPPPPK PVPKPKPKPK PQPRPKPAPK AVEPAPPAPP QPAAPPAPPA PAAAPAPLTP       180
     PSANAGYLHN PAPEYPALAM RRGWEGTVLL RVHVLASGSP SEIQVQKSSG REALDQAAVK       240
     AVKRWSFVPA KRGDKAEDGW VSVPIDFKLN                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page