(data stored in ACNUC7421 zone)

EMBL: CP000438.TRKA

CP000438.TRKA        Location/Qualifiers
FT   CDS             complement(17389..18762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="PA14_00170"
FT                   /product="potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14972"
FT                   /db_xref="GOA:A0A0H2ZJT5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT5"
FT                   /protein_id="ABJ14972.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKASFPTVLRQAGADDADMLVAVTNSDETNMVACQVAYTLFNTPTKIARVREPAY
FT                   LTRTGLFDNEAIPVDVLISPEQVVTNYIKRLIEHPGALQVIDFAEGKAQLVGIKAYYGG
FT                   PLVGQELRQLREHMPNVDTRVAAIYRRNRPIIPQGDTVIEADDEVFFIAAKAHIRAVMG
FT                   EMRRLDDSYKRIIIAGGGNVGERLAEAIESRYQVKIIERSPLRCRHLSDTLDSTIVLNG
FT                   SASDRDLLLEENIGETDVFLALTNDDEANIMSSLLAKRLGASKVMTLINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLAHVRRGDIESVHSLRRGAAEAIEVVAHGDAKSSKVIGRSIN
FT                   EIKLPPGTTIGALVRDEEVLIAHGDTHIESGDHVLLFLVDKKYIRDVERLFQAGLTFF"
     MKIIILGAGQ VGGTLAEHLA SEANDITVVD TDGDRLRDLG DRLDIRTVQG KASFPTVLRQ        60
     AGADDADMLV AVTNSDETNM VACQVAYTLF NTPTKIARVR EPAYLTRTGL FDNEAIPVDV       120
     LISPEQVVTN YIKRLIEHPG ALQVIDFAEG KAQLVGIKAY YGGPLVGQEL RQLREHMPNV       180
     DTRVAAIYRR NRPIIPQGDT VIEADDEVFF IAAKAHIRAV MGEMRRLDDS YKRIIIAGGG       240
     NVGERLAEAI ESRYQVKIIE RSPLRCRHLS DTLDSTIVLN GSASDRDLLL EENIGETDVF       300
     LALTNDDEAN IMSSLLAKRL GASKVMTLIN NPAYVDLVQG GEIDIAISPQ LATIGTLLAH       360
     VRRGDIESVH SLRRGAAEAI EVVAHGDAKS SKVIGRSINE IKLPPGTTIG ALVRDEEVLI       420
     AHGDTHIESG DHVLLFLVDK KYIRDVERLF QAGLTFF                                457
//

If you have problems or comments...

PBIL Back to PBIL home page