(data stored in ACNUC7421 zone)

EMBL: CP000438.YCEI

CP000438.YCEI        Location/Qualifiers
FT   CDS             485413..485988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceI"
FT                   /locus_tag="PA14_05510"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15390"
FT                   /db_xref="GOA:Q02TY9"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TY9"
FT                   /protein_id="ABJ15390.1"
FT                   /translation="MLKKTLAALALGSALFTAGQAMAADYKIDKEGQHAFIEFRIKHLG
FT                   YSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVSKNP
FT                   TATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLIGQGDDPWGGYRAGFEGSATLK
FT                   LKDFGIKMDLGPASQEVELLLSVEGIRQ"
     MLKKTLAALA LGSALFTAGQ AMAADYKIDK EGQHAFIEFR IKHLGYSWLY GRFNDFDGSF        60
     TFDEKNPSAD KVKVTINTNS VDTNHAERDK HLRSGDFLNV SKNPTATFES TEVKANGDSA       120
     DITGNLTLNG VTKPVTIKAK LIGQGDDPWG GYRAGFEGSA TLKLKDFGIK MDLGPASQEV       180
     ELLLSVEGIR Q                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page