(data stored in ACNUC7421 zone)

EMBL: CP000438.YCGB

CP000438.YCGB        Location/Qualifiers
FT   CDS             complement(656629..658182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgB"
FT                   /locus_tag="PA14_07650"
FT                   /product="putative sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15550"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLS6"
FT                   /protein_id="ABJ15550.1"
FT                   /translation="MSKRQPIATGSEWTFELIQQYDREISRIAERYALDTYPNQIEVIT
FT                   AEQMMDAYASVGMPIGYNHWSYGKHFLSTEKNYKRGQMGLAYEIVINSDPCIAYLMEEN
FT                   TQCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIMQCEERYGIDAVE
FT                   DLLDSCHALMNYGVDRYKRPYPISAEEERQRQKEREELIQRQVNDLWRTIPRVGGKDKE
FT                   QSMARYPSEPQENILYFIEKNAPLLEPWQREVIRIVRKIAQYFYPQRQTQVMNEGWATF
FT                   WHYTLLNDLYDEGLVNDGFMMEFLQYHTSVVYQPSFDSPYYSGINPYALGFAMYRDIRR
FT                   ICEEPTDEDRRWFPDIAGSDWLATLKFAMKSFKDESFILQFLSPKVIRDLKLFSILDDD
FT                   QKDDLLVAAIHDEAGYRTIRETLAAQYNLGNREPNIQIWNVDRRGDRSLTLRHQQFDRQ
FT                   PLSDSTADVLKHLHRLWGFDIHLETLQGDQLVQTHHMPPKGASEGEEGYPRLDLIIPPI
FT                   "
     MSKRQPIATG SEWTFELIQQ YDREISRIAE RYALDTYPNQ IEVITAEQMM DAYASVGMPI        60
     GYNHWSYGKH FLSTEKNYKR GQMGLAYEIV INSDPCIAYL MEENTQCMQA LVIAHACYGH       120
     NSFFKGNYLF RTWTDASSII DYLVFAKQYI MQCEERYGID AVEDLLDSCH ALMNYGVDRY       180
     KRPYPISAEE ERQRQKEREE LIQRQVNDLW RTIPRVGGKD KEQSMARYPS EPQENILYFI       240
     EKNAPLLEPW QREVIRIVRK IAQYFYPQRQ TQVMNEGWAT FWHYTLLNDL YDEGLVNDGF       300
     MMEFLQYHTS VVYQPSFDSP YYSGINPYAL GFAMYRDIRR ICEEPTDEDR RWFPDIAGSD       360
     WLATLKFAMK SFKDESFILQ FLSPKVIRDL KLFSILDDDQ KDDLLVAAIH DEAGYRTIRE       420
     TLAAQYNLGN REPNIQIWNV DRRGDRSLTL RHQQFDRQPL SDSTADVLKH LHRLWGFDIH       480
     LETLQGDQLV QTHHMPPKGA SEGEEGYPRL DLIIPPI                                517
//

If you have problems or comments...

PBIL Back to PBIL home page