(data stored in ACNUC7421 zone)

EMBL: CP000438.YCGM

CP000438.YCGM        Location/Qualifiers
FT   CDS             372315..372980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycgM"
FT                   /locus_tag="PA14_04150"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15281"
FT                   /db_xref="GOA:A0A0H2ZKV0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV0"
FT                   /protein_id="ABJ15281.1"
FT                   /translation="MSYQHQYIDGTPIHFPLGKLVCVGRNYAEHAKELNNPVPTEPLLF
FT                   IKPGSCVVPVSGGLSLPQERGSVHYEAEIAVLIGKPLSRKPNREEVLDAISGYAPALDL
FT                   TLREVQAKLKEKGLPWELAKSFDGAGVLSPFVNADQFPDPTDIGIRLTINGEVRQDGNS
FT                   RDMLNPIVPLIQHIAGHFSLQAGDVVLTGTPSGVGPLNSGDELLLELPGASRFETRVL"
     MSYQHQYIDG TPIHFPLGKL VCVGRNYAEH AKELNNPVPT EPLLFIKPGS CVVPVSGGLS        60
     LPQERGSVHY EAEIAVLIGK PLSRKPNREE VLDAISGYAP ALDLTLREVQ AKLKEKGLPW       120
     ELAKSFDGAG VLSPFVNADQ FPDPTDIGIR LTINGEVRQD GNSRDMLNPI VPLIQHIAGH       180
     FSLQAGDVVL TGTPSGVGPL NSGDELLLEL PGASRFETRV L                           221
//

If you have problems or comments...

PBIL Back to PBIL home page