(data stored in ACNUC7421 zone)

EMBL: CP000438.YHIN

CP000438.YHIN        Location/Qualifiers
FT   CDS             complement(626346..627524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiN"
FT                   /locus_tag="PA14_07280"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15522"
FT                   /db_xref="GOA:A0A0H2ZKU8"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU8"
FT                   /protein_id="ABJ15522.1"
FT                   /translation="MASTDVLIVGAGAAGLMCAMTAAGRGRRVRVLDHANKAGKKILMS
FT                   GGGRCNFTNLYTEPANFLSRNPHFCKSALARYTQWDFIGLVAKHQVPYHEKKLGQLFCD
FT                   NKSSDILEMLLRECAEAGAEILLDTSIEEIARDDAGYRLRTSAGEMRCESLVIASGGLS
FT                   IPTLGASGFGYQVARQFGHEVLPTRAGLVPFTITDQLKELCAELSGTSVDCRVSCNGQA
FT                   FRENLLFTHRGLSGPAMLQISSYWQPGDTLEIDLLPDHDASEWLAQQQRERPNSELKTL
FT                   LAELFTKKLAGLLADRWFVSKPMKQYTPTELAGIAGQLSAWRVTPSGTEGYRTAEVTLG
FT                   GVSTDEVSSKTMESQRSPGLYFVGEVLDVSGHLGGFNFQWAWASGYAAGQYA"
     MASTDVLIVG AGAAGLMCAM TAAGRGRRVR VLDHANKAGK KILMSGGGRC NFTNLYTEPA        60
     NFLSRNPHFC KSALARYTQW DFIGLVAKHQ VPYHEKKLGQ LFCDNKSSDI LEMLLRECAE       120
     AGAEILLDTS IEEIARDDAG YRLRTSAGEM RCESLVIASG GLSIPTLGAS GFGYQVARQF       180
     GHEVLPTRAG LVPFTITDQL KELCAELSGT SVDCRVSCNG QAFRENLLFT HRGLSGPAML       240
     QISSYWQPGD TLEIDLLPDH DASEWLAQQQ RERPNSELKT LLAELFTKKL AGLLADRWFV       300
     SKPMKQYTPT ELAGIAGQLS AWRVTPSGTE GYRTAEVTLG GVSTDEVSSK TMESQRSPGL       360
     YFVGEVLDVS GHLGGFNFQW AWASGYAAGQ YA                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page