(data stored in ACNUC7421 zone)

EMBL: CP000438.YICE

CP000438.YICE        Location/Qualifiers
FT   CDS             complement(408603..409988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="PA14_04610"
FT                   /product="putative xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15316"
FT                   /db_xref="GOA:A0A0H2ZKR9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR9"
FT                   /protein_id="ABJ15316.1"
FT                   /translation="MSSLQSPSDASARNDLVYGLDDRPSAPIALLAALQHLLAIIVPIV
FT                   TPGLLICQALGVSPRDTNLIVSMSLVISGIATFVQCKRFGPFGAGLLIVQGTSFNFVGP
FT                   LIAGGALMVKQGTPVESVMAAIFGVVIAGSFVEMGISRILPFVKRLITPLVTGIVVLMI
FT                   GLTLIKVGLISMGGGFSAMSNGTFANGENLLLSGVVLGIIVVLNRIPVVWMRSCAIVIA
FT                   LAVGYALAGYLGRLDFTGMHQAELFQVPTPLHFGLDFSWPLFIPMLVIYLVTSLEAIGD
FT                   VTATSKVSKQPVEGPLWMQRIKGGVLVNGANSFLAGIFNTFPSSVFAQNNGVIQLTGVA
FT                   SRYVGLWIAAMLVLLGLFPSVAGVIQAVPEPVLGGAAMVMFGAVAASGINILAGIQLDR
FT                   RALLIIAVSLALGLGVSQVPEFLAHMPAALRNVLESGVATGGICALLLNWFLPESPVQK
FT                   AGH"
     MSSLQSPSDA SARNDLVYGL DDRPSAPIAL LAALQHLLAI IVPIVTPGLL ICQALGVSPR        60
     DTNLIVSMSL VISGIATFVQ CKRFGPFGAG LLIVQGTSFN FVGPLIAGGA LMVKQGTPVE       120
     SVMAAIFGVV IAGSFVEMGI SRILPFVKRL ITPLVTGIVV LMIGLTLIKV GLISMGGGFS       180
     AMSNGTFANG ENLLLSGVVL GIIVVLNRIP VVWMRSCAIV IALAVGYALA GYLGRLDFTG       240
     MHQAELFQVP TPLHFGLDFS WPLFIPMLVI YLVTSLEAIG DVTATSKVSK QPVEGPLWMQ       300
     RIKGGVLVNG ANSFLAGIFN TFPSSVFAQN NGVIQLTGVA SRYVGLWIAA MLVLLGLFPS       360
     VAGVIQAVPE PVLGGAAMVM FGAVAASGIN ILAGIQLDRR ALLIIAVSLA LGLGVSQVPE       420
     FLAHMPAALR NVLESGVATG GICALLLNWF LPESPVQKAG H                           461
//

If you have problems or comments...

PBIL Back to PBIL home page