(data stored in ACNUC7421 zone)

EMBL: CP000438.YQJC

CP000438.YQJC        Location/Qualifiers
FT   CDS             complement(609732..610151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjC"
FT                   /locus_tag="PA14_07040"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15505"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT4"
FT                   /protein_id="ABJ15505.1"
FT                   /translation="MSIRPSLPLAGLLLAVSLPLSAAQPGTTKGAPLSGCAAKQAAIEA
FT                   KLETARSFANEGQVAGLEKALSEVKEHCTEAGLLRENKQKVIDSEREVSEREKDLRKAM
FT                   GKGDPEKIEKRKAKLAEARAELEEAKKGLEQAQAQ"
     MSIRPSLPLA GLLLAVSLPL SAAQPGTTKG APLSGCAAKQ AAIEAKLETA RSFANEGQVA        60
     GLEKALSEVK EHCTEAGLLR ENKQKVIDSE REVSEREKDL RKAMGKGDPE KIEKRKAKLA       120
     EARAELEEAK KGLEQAQAQ                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page