(data stored in ACNUC7421 zone)

EMBL: CP000462.APHA

CP000462.APHA        Location/Qualifiers
FT   CDS             450541..451434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aphA"
FT                   /locus_tag="AHA_0425"
FT                   /product="HAD-superfamily (subfamily iiib) phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF03767;
FT                   match to protein family HMM TIGR01672"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39054"
FT                   /db_xref="GOA:A0KFD2"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR010025"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFD2"
FT                   /protein_id="ABK39054.1"
FT                   /translation="MGPVVGTGLGAHAMLFGDCAKMGACRGDACHLALFCGGFHGFRCR
FT                   HGAGSAPCFLHVTSRIMSLSPRFALLASLVAASLTLPAVAVEAPASPAGVTAVTLAQQA
FT                   PIHWVSVTQIAKSLDGLPPMAVGFDIDDTLLFSSPGFYRGKQEFSPNDESYLKNPAFWE
FT                   KMNNGWDAFSVPKEVGKALIAMHLERGDHIYFVTGRSATKTETVSQTLQQTMNIPADQL
FT                   NPVIFAGDQPGQNTKVQWLKEKQMKIFYGDADGDIKAAQELGIRGIRLLRSANSTYRPL
FT                   PLAGALGEEVIVNSQY"
     MGPVVGTGLG AHAMLFGDCA KMGACRGDAC HLALFCGGFH GFRCRHGAGS APCFLHVTSR        60
     IMSLSPRFAL LASLVAASLT LPAVAVEAPA SPAGVTAVTL AQQAPIHWVS VTQIAKSLDG       120
     LPPMAVGFDI DDTLLFSSPG FYRGKQEFSP NDESYLKNPA FWEKMNNGWD AFSVPKEVGK       180
     ALIAMHLERG DHIYFVTGRS ATKTETVSQT LQQTMNIPAD QLNPVIFAGD QPGQNTKVQW       240
     LKEKQMKIFY GDADGDIKAA QELGIRGIRL LRSANSTYRP LPLAGALGEE VIVNSQY          297
//

If you have problems or comments...

PBIL Back to PBIL home page