(data stored in ACNUC7421 zone)

EMBL: CP000462.ARGC

CP000462.ARGC        Location/Qualifiers
FT   CDS             631237..632244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="AHA_0593"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01850"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37991"
FT                   /db_xref="GOA:A0KFV0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFV0"
FT                   /protein_id="ABK37991.1"
FT                   /translation="MLNTVIVGASGYAGAELAALVQNHPQLKLFGLYVSAGSQDAHKRF
FT                   SSLHPQWVGALDQPLLPLDEDGMTRILTQADLVLLATAHEVSATLAPKFLAKGLPVFDL
FT                   SGAFRVRDQQFYASYYGFTHDSEQWLDQAAYGLAEWNAEAVKAAQLIAVPGCYPTASLC
FT                   ALKPLQQAGLIAKGWQPIINAVSGVSGAGRKAAINTSFCEVSLNPYGTFNHRHQPEISH
FT                   HLGKEVLFQPHLGNYVRGILATIYVQLADGVTPTQVDQAYLKAYEGKPLVRLTGQMPSI
FT                   RGVAGTPYCDLAWQQQGNMLVVVCAIDNLLKGAASQAMQCINIKFGFEPATGLI"
     MLNTVIVGAS GYAGAELAAL VQNHPQLKLF GLYVSAGSQD AHKRFSSLHP QWVGALDQPL        60
     LPLDEDGMTR ILTQADLVLL ATAHEVSATL APKFLAKGLP VFDLSGAFRV RDQQFYASYY       120
     GFTHDSEQWL DQAAYGLAEW NAEAVKAAQL IAVPGCYPTA SLCALKPLQQ AGLIAKGWQP       180
     IINAVSGVSG AGRKAAINTS FCEVSLNPYG TFNHRHQPEI SHHLGKEVLF QPHLGNYVRG       240
     ILATIYVQLA DGVTPTQVDQ AYLKAYEGKP LVRLTGQMPS IRGVAGTPYC DLAWQQQGNM       300
     LVVVCAIDNL LKGAASQAMQ CINIKFGFEP ATGLI                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page