(data stored in ACNUC7421 zone)

EMBL: CP000462.ARGH

CP000462.ARGH        Location/Qualifiers
FT   CDS             635484..636869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="AHA_0597"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36163"
FT                   /db_xref="GOA:A0KFV4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFV4"
FT                   /protein_id="ABK36163.1"
FT                   /translation="MALWGGRFSQGADSRFKQFNDSLRFDYRLAEQDIQGSMAWAKALV
FT                   KVGVLTADEQGKLQQAMEVLLASVQQDPQQILISDAEDIHSWVESALIAAVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKAQGELLLGSITALQQGLVASARANQAAVLPGYTHLQRAQPV
FT                   TYAHWALAYVEMLERDYSRLQDALKRLDTSPLGCGALAGTAYAIDREALALDMGFAGAT
FT                   RNSLDSVSDRDHVVELMHVASLSMTHLSRFAEDLIFYNTGEAGFVELSDAVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVVGAQMGMLMSLKALPLAYNKDMQEDKEGLFDALDTWHDCLD
FT                   MAALVLIDLKVNGERTMAAAQGGYANATELADYLVAKGIPFREAHHIVGETVVYAIQVK
FT                   KPLEELTIGEFQRFSPVIEFDVYPNLELEATLAKRVAKGGVAREQVEAALIAAETWLAK
FT                   RAG"
     MALWGGRFSQ GADSRFKQFN DSLRFDYRLA EQDIQGSMAW AKALVKVGVL TADEQGKLQQ        60
     AMEVLLASVQ QDPQQILISD AEDIHSWVES ALIAAVGDLG KKLHTGRSRN DQVATDLKLW       120
     CKAQGELLLG SITALQQGLV ASARANQAAV LPGYTHLQRA QPVTYAHWAL AYVEMLERDY       180
     SRLQDALKRL DTSPLGCGAL AGTAYAIDRE ALALDMGFAG ATRNSLDSVS DRDHVVELMH       240
     VASLSMTHLS RFAEDLIFYN TGEAGFVELS DAVTSGSSLM PQKKNPDALE LIRGKTGRVV       300
     GAQMGMLMSL KALPLAYNKD MQEDKEGLFD ALDTWHDCLD MAALVLIDLK VNGERTMAAA       360
     QGGYANATEL ADYLVAKGIP FREAHHIVGE TVVYAIQVKK PLEELTIGEF QRFSPVIEFD       420
     VYPNLELEAT LAKRVAKGGV AREQVEAALI AAETWLAKRA G                           461
//

If you have problems or comments...

PBIL Back to PBIL home page