(data stored in ACNUC7421 zone)

EMBL: CP000462.BRNQ-1

CP000462.BRNQ-1      Location/Qualifiers
FT   CDS             461811..463145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ-1"
FT                   /locus_tag="AHA_0434"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by similarity to SP:P37011; match to
FT                   protein family HMM PF05525; match to protein family HMM
FT                   TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38708"
FT                   /db_xref="GOA:A0KFE1"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFE1"
FT                   /protein_id="ABK38708.1"
FT                   /translation="MNNQKLTSRDIVALGFMTFALFVGAGNIIFPPMVGLQAGEQVWGA
FT                   AAGFLLTAVGLPVLTVVALAKVGGGVDALSAPIGRKAGLLLATVCYLAVGPLFATPRTA
FT                   TVSYEVGLAPLFGDDGSALLIYSLVYFSLVIGISLYPGRLLDTVGHVLAPIKILALAAL
FT                   GLAVLLWPAGSAIPAVESYQHQPFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVSSA
FT                   KLLTRYTVLAGLIAGMGLTLVYLSLFRLGSVSGELVPHAQNGAEILHAYVQHTFGNMGS
FT                   GFLALLIFIACLVTAVGLTCACAEFFAQYLPLSYRTLVLLLGGFSMLVSNLGLSHLIQL
FT                   SVPVLTAIYPPCIVLVVLSFTLRWWGNGTRVVGPVMLISLLFGLIDGLKASALAGLLPA
FT                   WSLALPLNEQGLAWLPPSLCALLLAALWDRLQGRPQVASVSKSAA"
     MNNQKLTSRD IVALGFMTFA LFVGAGNIIF PPMVGLQAGE QVWGAAAGFL LTAVGLPVLT        60
     VVALAKVGGG VDALSAPIGR KAGLLLATVC YLAVGPLFAT PRTATVSYEV GLAPLFGDDG       120
     SALLIYSLVY FSLVIGISLY PGRLLDTVGH VLAPIKILAL AALGLAVLLW PAGSAIPAVE       180
     SYQHQPFSNG FVNGYLTMDT LGAMVFGIVI VNAARSRGVS SAKLLTRYTV LAGLIAGMGL       240
     TLVYLSLFRL GSVSGELVPH AQNGAEILHA YVQHTFGNMG SGFLALLIFI ACLVTAVGLT       300
     CACAEFFAQY LPLSYRTLVL LLGGFSMLVS NLGLSHLIQL SVPVLTAIYP PCIVLVVLSF       360
     TLRWWGNGTR VVGPVMLISL LFGLIDGLKA SALAGLLPAW SLALPLNEQG LAWLPPSLCA       420
     LLLAALWDRL QGRPQVASVS KSAA                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page