(data stored in ACNUC7421 zone)

EMBL: CP000462.CPXA

CP000462.CPXA        Location/Qualifiers
FT   CDS             complement(204372..205727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="AHA_0189"
FT                   /product="sensor histidine kinase CpxA"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by similarity to SP:P08336; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37467"
FT                   /db_xref="GOA:A0KEQ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ7"
FT                   /protein_id="ABK37467.1"
FT                   /translation="MRTARTFNGLSTQIFLWFWFMLLLVVAAVVILPTLDPRNIIPLPA
FT                   HEITRLNNNLKALQKGADPNQDFDLAQAIDAAGLLPVDNIYLRDAKGQMQSSTRLSKFV
FT                   IRFMLDSDNPAKPMLGSEHKRAIAGPFQMTHHGQIYHIYFGLNVENSYLFLFIQILDHP
FT                   IQILGIAMLVSTPLCLLLAWRLTRPILQLQQSVSQLAEGNLEAQIPNLGRRDEIGQLAD
FT                   HVSHMVDTLKNMIQKQKQLLSDISHELRSPLTRIQLAQALIRRKQGDSNELVRIESEIG
FT                   RLDKLIGDLLDLSRVQQHVEAPVVMPLAELLEPILDDAMFEANQSGKQLRLPPLPAESL
FT                   RMWPDLLARALENPLRNALKYAREFIKVDWYREGLEWVMTIRDDGPGVPVAQQAQLFLP
FT                   FFRVDDARNAKTGGTGLGLAIAAEAIARHGGTIRASSNQPAGLTITIRLPIG"
     MRTARTFNGL STQIFLWFWF MLLLVVAAVV ILPTLDPRNI IPLPAHEITR LNNNLKALQK        60
     GADPNQDFDL AQAIDAAGLL PVDNIYLRDA KGQMQSSTRL SKFVIRFMLD SDNPAKPMLG       120
     SEHKRAIAGP FQMTHHGQIY HIYFGLNVEN SYLFLFIQIL DHPIQILGIA MLVSTPLCLL       180
     LAWRLTRPIL QLQQSVSQLA EGNLEAQIPN LGRRDEIGQL ADHVSHMVDT LKNMIQKQKQ       240
     LLSDISHELR SPLTRIQLAQ ALIRRKQGDS NELVRIESEI GRLDKLIGDL LDLSRVQQHV       300
     EAPVVMPLAE LLEPILDDAM FEANQSGKQL RLPPLPAESL RMWPDLLARA LENPLRNALK       360
     YAREFIKVDW YREGLEWVMT IRDDGPGVPV AQQAQLFLPF FRVDDARNAK TGGTGLGLAI       420
     AAEAIARHGG TIRASSNQPA GLTITIRLPI G                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page